DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP004200

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_313096.5 Gene:AgaP_AGAP004200 / 1274036 VectorBaseID:AGAP004200 Length:282 Species:Anopheles gambiae


Alignment Length:266 Identity:61/266 - (22%)
Similarity:119/266 - (44%) Gaps:22/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVD 91
            ||..:..:..|:...|||...|:.:||| ||....:..|..:|..:.||:.|:....:.|:|.:|
Mosquito    21 RATDVQKLGEWVKGQPHLPPVTELELIL-FLHSNYYDLEAAQRTIECYYTFRTSCKNLFGNRNLD 84

  Fly    92 EALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALEC------ 150
            :..:......:.:..:..::|||.||::::.  :||      :|.|.....|..|||.|      
Mosquito    85 KDAILMAMDVLDLAILPELTPEGYRVMLAKI--VDP------DASKFSLSSLLTLALMCVDIQLW 141

  Fly   151 DNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVT 215
            :....:|.|.::|...:.:..:.:...|.||.....:.:.:|:|...:|:.|:......|...:.
Mosquito   142 EEGCNNGSILIIDMDGIHLGHLPKLGIFTLKDLLYFIQEGLPIRLKGLHLANVVPFIDRIMTMIR 206

  Fly   216 KFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYG-GTNGYQAEAVDHWR-----QKLLDSKDYLA 274
            .|:..:|.....:|.|...|:.::|:.::..:|| ....|.....||..     :::::||.: |
Mosquito   207 PFMKKELLEMLHLHTKMHTLFPYIPQHLLPSDYGDNLYNYTISCGDHLARYDQDKRVVESKRH-A 270

  Fly   275 KDAQYG 280
            |....|
Mosquito   271 KPRTMG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/162 (20%)
AgaP_AGAP004200XP_313096.5 CRAL_TRIO 98..240 CDD:279044 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.