DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP002835

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_312077.3 Gene:AgaP_AGAP002835 / 1273125 VectorBaseID:AGAP002835 Length:285 Species:Anopheles gambiae


Alignment Length:297 Identity:72/297 - (24%)
Similarity:126/297 - (42%) Gaps:28/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLG 86
            ||.|:|      :|.|||..|||.......|:..::.......|..|:.|...|:||...|.:..
Mosquito    10 EEGAER------LKDWITTQPHLPQNIHPTLLQRYIHSTHGDLEYAKKIFILGYTLRQNNPTIFD 68

  Fly    87 SRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALECD 151
            :|....:.:..:.:.|.::|:..|.....:.|..:..:.||.|.:..:..|..||:.:|..::.|
Mosquito    69 NRDPLNSNVMNILKAIDMVPLPSVEGCEDKFIYYRLVDCDPDKFDFNDVIKTFFIIADLRMIQPD 133

  Fly   152 ---NAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNF 213
               |.  .|.:.:.|....|:..|.:.....|:.......:..|:|...||:||.......:...
Mosquito   134 VPMND--GGDVPIFDMNGFTLRHMTKVVLSTLRVYMRYTQEAHPVRLKAIHVINCTPFLDRVMCL 196

  Fly   214 VTKFLPSKLPFKFVVH-KKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDH---WRQKLLDSKDYLA 274
            |..|:..::......| ..||.:|.|||:..:..||||    :...:.|   |..::...:||:.
Mosquito   197 VKPFMKKRVAEMLHFHLPNSETIYAHLPKAALPDEYGG----EQSIIKHKEDWFNRIKLQRDYIT 257

  Fly   275 KDAQYGTNEKLRVGLASAWANGELDGMSGSFRKLELD 311
            ...::..:|..|       :||  :.:||:.||||:|
Mosquito   258 DGTRWKIDESRR-------SNG--NDLSGTLRKLEID 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 36/159 (23%)
AgaP_AGAP002835XP_312077.3 SEC14 100..235 CDD:238099 34/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.