DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP003733

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_003436587.1 Gene:AgaP_AGAP003733 / 1271466 VectorBaseID:AGAP003733 Length:293 Species:Anopheles gambiae


Alignment Length:270 Identity:59/270 - (21%)
Similarity:116/270 - (42%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSP 112
            ||:|| ..||..|..:.:||::....||..|...||:..:|....|.:.|..:.....|: |.:|
Mosquito    39 TDKQL-ACFLDACDKNIDETRKVLKIYYEARKNGPELFNNRDPHSAAIQQCLQNQDYFPL-PPTP 101

  Fly   113 EGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALEC--DNAAISGLIWVVDARDVTMEQMMQY 175
            .|..|:..:.:|......:..||.|..|:.::    .|  ......|:|::.|.::|.:..:.:.
Mosquito   102 SGYSVVFHRLKNSRSSNYHFDEAIKTYFMTID----SCLYTQGPRPGIIFLFDMKNVGLMHLTRI 162

  Fly   176 DPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDL---YQ 237
            :...::|.|..:...:|.:...||::|:......|...:..|:.:::.....:|..|.:|   |:
Mosquito   163 NMSSVRKFFHYLQDGLPAKLKAIHVMNVVSFFDKILYIIKPFIHAEILNVLYLHTSSANLDSFYE 227

  Fly   238 H-LPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLAKDAQYGTNEKLRVGLASAWANGELDGM 301
            . :|:..:..:.||    ..:::|...|..|  |::......:...|:.|.|.|....:...|.|
Mosquito   228 EWIPKSGLPSDLGG----DMKSIDELHQDHL--KEFERLRPYFLAEERQRNGEAGNLIDEPTDRM 286

  Fly   302 SGSFRKLELD 311
               .:.|.:|
Mosquito   287 ---LKSLSID 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 30/161 (19%)
AgaP_AGAP003733XP_003436587.1 SEC14 94..241 CDD:238099 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.