DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP009385

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_559860.3 Gene:AgaP_AGAP009385 / 1271293 VectorBaseID:AGAP009385 Length:292 Species:Anopheles gambiae


Alignment Length:282 Identity:66/282 - (23%)
Similarity:120/282 - (42%) Gaps:47/282 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQE---ETKRRF- 71
            :|..:|:.|..|....||:.:..::..:.::..:....:|..:|.|||.|.|..|   :..||. 
Mosquito    16 ELMEIARRELRETPEMRAQAVEELRALLREAKDMHFSEEEAFLLIFLRPCHFYAESALKMMRRIA 80

  Fly    72 ----DNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNI-DPKKSN 131
                .|:..|.::.||       :|.|.......::|:..|  ..:|.||::...... |||..:
Mosquito    81 EFKKTNHPLLHALKPE-------EEKLAFVEHNVVNVLTNR--DQKGRRVLLVNCGAAWDPKAVS 136

  Fly   132 PREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFV 196
            ..:.|: :|.::.|:|.......|:|::.|:|...::::|:....|...|:....:...:|||..
Mosquito   137 SEQLFR-VFFLIHLVAQLEPATQINGVVVVLDFDGLSLKQVKALSPSFSKRLITFIQDAMPLRLK 200

  Fly   197 EIHMINMRKEGQTIFNFV----TKFLPSKLPFKFVVHKKSEDL---YQHLPRDVMTIEYGGTNGY 254
            |:|::..    ..|||.|    ..|:..||..:...|  ..||   :|::..|.:..:|||.   
Mosquito   201 EVHILKQ----PYIFNMVWALFKPFIREKLKSRIFFH--GNDLSKFHQYISVDRLPADYGGN--- 256

  Fly   255 QAEAVDHWRQKLLDSKDYLAKD 276
                        |.:.||..||
Mosquito   257 ------------LPAIDYTGKD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 38/163 (23%)
AgaP_AGAP009385XP_559860.3 CRAL_TRIO_N 33..78 CDD:215024 9/44 (20%)
CRAL_TRIO 108..256 CDD:279044 38/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.