DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP009366

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_310043.3 Gene:AgaP_AGAP009366 / 1271282 VectorBaseID:AGAP009366 Length:172 Species:Anopheles gambiae


Alignment Length:138 Identity:34/138 - (24%)
Similarity:56/138 - (40%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLP 219
            ::|:..:.|...::|..:.|..|.....:...:.:|.||:...||::|.......:|.....|:.
Mosquito    39 VNGIRIIFDFDGLSMSHVAQASPKHAMVSLQWIQKCCPLQLKSIHIVNNSMLFNVLFTIFKPFIS 103

  Fly   220 SKLPFKFVVHKKSEDLYQHLPRDV----MTIEYGGTNGYQAEAVDHWRQKLLD-----SKDYLAK 275
            .:|..|...|.:.   |..|.:.:    :...||||    .:|.|...|.|.|     .|.|.|.
Mosquito   104 KELRDKMHFHNRD---YSGLTKCISAKCLPPAYGGT----LDAPDCEGQLLGDFMQLYDKHYEAM 161

  Fly   276 DAQYGTNE 283
            || :|..|
Mosquito   162 DA-FGYEE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 20/99 (20%)
AgaP_AGAP009366XP_310043.3 CRAL_TRIO 8..136 CDD:279044 20/99 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.