DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP009365

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_310041.4 Gene:AgaP_AGAP009365 / 1271280 VectorBaseID:AGAP009365 Length:186 Species:Anopheles gambiae


Alignment Length:194 Identity:39/194 - (20%)
Similarity:83/194 - (42%) Gaps:21/194 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IATIKTWITKSPHLKAPT-DEQLILAFLRRCRFSQEETKRRFDNYYSLR---SVFPEVLGSRQVD 91
            |..::..|.:...||.|. ||..:..|||..::..|.|......:|.::   :...:.|.::.:.
Mosquito     5 IRKLRELIQQEKQLKLPVDDESFMKRFLRPKKYYPESTFEMLKAFYHMKAKQNFISDRLTTKSIQ 69

  Fly    92 EALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPK----KSNPREAFKLIFIMLELLALECDN 152
            .||   ..|.:.::|.|  ...|.|::   :..:..|    |....|..:...:::|::..| ..
Mosquito    70 NAL---DDRAVQILPKR--DQHGRRIL---YMEMGAKWNCTKVPSMEVIRCTNMLMEMVGRE-PA 125

  Fly   153 AAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMRKEGQTIFNFVTK 216
            ..:.|:::|::...:::..:.|:.|..:|.......:..|.|...||::|..:    :||...|
Mosquito   126 TQLHGIVFVINFDRLSLSHISQFPPKFVKTVVDHGQKHSPYRIKGIHIVNNAR----MFNIFFK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 23/126 (18%)
AgaP_AGAP009365XP_310041.4 CRAL_TRIO_N 2..47 CDD:215024 12/41 (29%)
CRAL_TRIO 77..>186 CDD:279044 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.