DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP009364

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_310039.4 Gene:AgaP_AGAP009364 / 1271279 VectorBaseID:AGAP009364 Length:308 Species:Anopheles gambiae


Alignment Length:282 Identity:59/282 - (20%)
Similarity:115/282 - (40%) Gaps:27/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALAKSECNEEQAQRAEII----ATIKTWITKSPHLKAPTD-EQLILAFLRRCRFSQEETKRRFDN 73
            |.||.:...|..:..:::    ..:::.:.:...|..|.| :..::.|||.|::..:........
Mosquito    32 AKAKEKAARELRETPDVVEQSLQELRSLLQEEKTLYVPMDNDAFMIKFLRPCKYYAQSAFELIKR 96

  Fly    74 YYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQF-RNIDPKKSNPREAFK 137
            ||..||..|::..............:..:|.:|:|  ...|.|:::.:. :...|.|.:..:.|:
Mosquito    97 YYRFRSKHPDLCDELYPASVKHVYAEGLVHFLPLR--DQHGSRILVLECGKKWKPSKVSLTDLFR 159

  Fly   138 LIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMIN 202
            .:.:.||....| ....::|.:.::|...:.:.|:||:.|.....|...:.||..:|...:|::|
Mosquito   160 AVQLALEAGMYE-PRTQLNGAVVILDMEGLALSQIMQFTPKFAAMALDWIQQCTAMRLKSVHIVN 223

  Fly   203 MRKEGQTIFNFVTKFLPSKLPFKFVVHKKS-EDLYQHLPRDVMTIEYGGTNGYQAEAVD------ 260
            .......:|.....||..||..:...|:|. ..|..|:....:..:||||    .|.::      
Mosquito   224 NSYLFNMLFAIFKPFLSEKLRKRLFFHQKDWNSLMSHVEAKCLRPKYGGT----LECLETDGMLL 284

  Fly   261 -------HWRQKLLDSKDYLAK 275
                   |...:|.:|..||.|
Mosquito   285 GEMFELYHKEYELANSFGYLKK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 34/157 (22%)
AgaP_AGAP009364XP_310039.4 CRAL_TRIO_N 50..97 CDD:215024 7/46 (15%)
SEC14 127..273 CDD:238099 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.