DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP009312

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_309981.3 Gene:AgaP_AGAP009312 / 1271257 VectorBaseID:AGAP009312 Length:266 Species:Anopheles gambiae


Alignment Length:221 Identity:48/221 - (21%)
Similarity:91/221 - (41%) Gaps:33/221 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPE-----------VLGSRQVDEALLTQLQRG 101
            :||..:..||..|.:..:|...|......|:...||           .|.:|.|..||..:.:||
Mosquito    36 SDELFLCRFLYCCDWDVQEAFGRIVKLIKLKEANPEWFFHKPIATYSELLNRNVKFALDRRDRRG 100

  Fly   102 IHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLELLALECDNAAISGLIWVVDARD 166
            ..|...|..:.:...:.::...|:|.             |..||:..|.:... ||:..::|...
Mosquito   101 RRVFITRLGAIDFSSMAVTDLANLDD-------------IWFELMLNELETLE-SGVTCLIDMSG 151

  Fly   167 VTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMIN----MRKEGQTIFNFVTKFLPSKLPFKFV 227
            .:::......|..::...|..| .:||:.:|.|::|    |......::..::|.:..::.|.: 
Mosquito   152 YSLKSFRFLTPQNIRIGSAKTD-LLPLKNIEFHVVNSSVFMNAAIAILYPMLSKKIKDQVRFHY- 214

  Fly   228 VHKKSEDLYQHLPRDVMTIEYGGTNG 253
              .....|::::|.|::..|||||.|
Mosquito   215 --SNWASLHEYIPADILPAEYGGTAG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 30/159 (19%)
AgaP_AGAP009312XP_309981.3 CRAL_TRIO_N <32..61 CDD:215024 7/24 (29%)
CRAL_TRIO 103..236 CDD:279044 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.