DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP007353

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_308476.4 Gene:AgaP_AGAP007353 / 1269826 VectorBaseID:AGAP007353 Length:331 Species:Anopheles gambiae


Alignment Length:321 Identity:67/321 - (20%)
Similarity:143/321 - (44%) Gaps:25/321 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHL-KAPTDEQLILAFLRRCRFSQEETKRR 70
            |||.:....|..|.:|.:..|...:|.::.:|.|.|.: :..||...:|.|||..:|:..:....
Mosquito    20 TLDERDLVRAAEELHENEDTRESSLALMREFIAKHPQIVRCRTDPVFLLRFLRYRKFNVNDACAT 84

  Fly    71 FDN----YYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPR--VIISQFRNIDPKK 129
            .:.    ...:|:::...:.|      ....:||.:.:..:.|:..:..|  ||:.:...:|||:
Mosquito    85 LEGGLAFLMRMRTLYGAEVSS------FHPNVQRMVELDAIVPLGQDRQRRTVILVRVGAMDPKE 143

  Fly   130 SNPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLR 194
            :......:|..:::. ..||.:...:.|.:||||...:||..:..:....:|.....:::.:.:.
Mosquito   144 TTALLQMRLGALVIN-TCLEYERTQVHGTVWVVDCSGMTMAHVGMWGLSEVKMMADSINEVVTMF 207

  Fly   195 FVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAV 259
            ..|:||:.:.:....:.:.:...|..|:..:|..|:..::|:..:.:.::....||....: :|.
Mosquito   208 VKEVHMVKVPRITWMLLDLLLPLLSPKIRDRFKFHRTEQELHSAIDQTLLPTTCGGQQSLK-QAS 271

  Fly   260 DHWRQKLLDSKDYLAKDAQYGTNEKLRV-GLASAWAN--------GELDGMSGSFRKLELD 311
            |::|........:...:.|:..:..:.. |.:|:.|.        || :.|.||||||.:|
Mosquito   272 DNFRDMFEKQTKWFKLEEQFLMDLSIPAPGSSSSSARTAHRNEFPGE-ESMVGSFRKLTVD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 29/157 (18%)
AgaP_AGAP007353XP_308476.4 CRAL_TRIO_N 41..86 CDD:215024 11/44 (25%)
CRAL_TRIO 119..264 CDD:279044 27/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.