DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP007358

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_001687951.1 Gene:AgaP_AGAP007358 / 1269821 VectorBaseID:AGAP007358 Length:376 Species:Anopheles gambiae


Alignment Length:311 Identity:73/311 - (23%)
Similarity:137/311 - (44%) Gaps:14/311 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHL-KAPTDEQLILAFLRRCRFSQEETKRRF 71
            |..|...:|:.|..|:...|...:...:.||.|.|.: |..||...:|.|||..:||........
Mosquito    73 LPDKFKIMAQDELREDDDMRENALKQFREWIAKHPLIRKCRTDAPFLLRFLRTKKFSIPAATEML 137

  Fly    72 DNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAF 136
            :.|.::|.|:|.......:::..|..:....::..:......|.::|.|.....|..:....:..
Mosquito   138 EKYLTIRQVYPHWFFKLDINDPDLEAIIDSGYLFALPERDEHGRKIIFSNAGKFDTSRFTSAQLI 202

  Fly   137 KLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMI 201
            |:..::||.|..| :.:.|||.|.|.|..::.:..:..:....::.....|...:|:|..|.|.:
Mosquito   203 KIHSMVLEALQDE-EESQISGYIHVTDDSELNIGFLSIWSFTDIRNLAHCVQNSLPMRQKENHFV 266

  Fly   202 NMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYGGTNGYQAEAVDHWRQKL 266
            ::......:..|:...|..||..:..||:..::....:...::..|||||.. .||.:..::::|
Mosquito   267 SLPSFANKLSEFILSVLSEKLRNRVFVHRGWDEAKTKINPKLLPKEYGGTVP-MAECIAQFKKQL 330

  Fly   267 LDSKD-YLAKDAQYGTNEKLRVGLAS-AWANGE----LDGMSGSFRKLELD 311
            .:.:| .||.|..     ::.:..:: .||:..    ..|:.|||||||:|
Mosquito   331 KERRDIVLALDEM-----EIEINKSTIPWADSTDADIASGVIGSFRKLEVD 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 30/155 (19%)
AgaP_AGAP007358XP_001687951.1 CRAL_TRIO_N 93..140 CDD:215024 13/46 (28%)
CRAL_TRIO 168..316 CDD:279044 29/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29493
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.