DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and AgaP_AGAP013350

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_003436739.1 Gene:AgaP_AGAP013350 / 11175508 VectorBaseID:AGAP013350 Length:282 Species:Anopheles gambiae


Alignment Length:277 Identity:65/277 - (23%)
Similarity:125/277 - (45%) Gaps:28/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEQAQR--AEIIAT----IKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSV 80
            |:|.:|  .|:.||    :..|:...|||.:.|:.:||| ||....:..|..:|..:.||:.|:.
Mosquito    10 EDQYRRYAGELRATDVQKLGEWVKGQPHLPSVTELELIL-FLHSNYYDLEAAQRTIECYYTFRTS 73

  Fly    81 FPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLIFIMLEL 145
            ...:..:|.:|:..:......:.:..:..::|||.||::::.  :||      :|.|.....|..
Mosquito    74 CKNLFANRNLDKDAILMAMDVLDLAILPELTPEGYRVMLAKI--VDP------DASKFSLSSLLT 130

  Fly   146 LALEC------DNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRFVEIHMINMR 204
            |||.|      :....:|.|.::|...:.:..:.:...|.||.....:.:.:|:|...:|:.|:.
Mosquito   131 LALMCVDIQLWEEGCNNGSILIIDMDGIHLGHLPKLGIFTLKDLLYFIQEGLPIRLKGLHLANVV 195

  Fly   205 KEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEYG-GTNGYQAEAVDHWR----- 263
            .....|...:..|:..:|.....:|.|...|:.::|:.::..:|| ....|.....||..     
Mosquito   196 PFIDRIMTMIRPFMKKELLEMLHLHTKMHTLFPYIPQHLLPSDYGDNLYNYTISCGDHLARYDQD 260

  Fly   264 QKLLDSKDYLAKDAQYG 280
            :::::|| .|||....|
Mosquito   261 KRVVESK-RLAKPRTMG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 33/162 (20%)
AgaP_AGAP013350XP_003436739.1 CRAL_TRIO 98..240 CDD:279044 31/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.