DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10300 and spint1

DIOPT Version :9

Sequence 1:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster
Sequence 2:XP_002939591.2 Gene:spint1 / 100488118 XenbaseID:XB-GENE-968962 Length:511 Species:Xenopus tropicalis


Alignment Length:214 Identity:37/214 - (17%)
Similarity:69/214 - (32%) Gaps:65/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANTLRTLDPKLAALAKSECNEEQAQRAEIIATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQE 65
            |....|||...||...:::..|:......:|..:             .:::.:..|:|:..|...
 Frog    65 MTACCRTLGCNLALAQETDNGEDVINSCFLINCV-------------YEQEFVCKFIRKPGFVNF 116

  Fly    66 ETKRRFDNYYSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKS 130
            .|...::.|.::..                   |.|....|  |::..||.|           ::
 Frog   117 ITMDVYNKYQAMME-------------------QEGDEDHP--PIARAGPDV-----------RT 149

  Fly   131 NPREAFKLIFIMLELLALECDNAAISGLIWVVDARDVTMEQMMQYDPFLLKKAFALVDQCIPLRF 195
            .|.:.  :|...:|.|    |...|....|          .::..||.::.:.....:..:|   
 Frog   150 QPLQT--VILTGIESL----DREGIVSYEW----------SLLHGDPSVVYEVIPATESDVP--- 195

  Fly   196 VEIHMINMRKEGQTIFNFV 214
            ..|.:.|:. .||.||..|
 Frog   196 HSIEVTNLH-AGQYIFQLV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10300NP_651174.2 SEC14 95..251 CDD:238099 24/120 (20%)
spint1XP_002939591.2 MANEC 25..115 CDD:400058 11/62 (18%)
PKD <160..230 CDD:238084 15/72 (21%)
KU 240..291 CDD:238057
LDLa 319..353 CDD:238060
Kunitz_BPTI 374..425 CDD:394972
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165165535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.