DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and PDR17

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_014135.1 Gene:PDR17 / 855457 SGDID:S000005208 Length:350 Species:Saccharomyces cerevisiae


Alignment Length:179 Identity:36/179 - (20%)
Similarity:69/179 - (38%) Gaps:48/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRRIDRYFT 73
            |..:.|......|..:::..:::.....::|.:  .||....|:..|.|...:::          
Yeast   181 LVYMMETATTVAPQGVEKITVLVDFKSYKEPGI--ITDKAPPISIARMCLNVMQD---------- 233

  Fly    74 HYNLFPEIMNNRCVTQRLLDIN-------RMGVCLYPDMPKGDSRSAMFIARF-GHFDPNLYMLR 130
            ||   ||.: .:||   |::|.       :|   :||.:.......|:|...| .|.:|:     
Yeast   234 HY---PERL-AKCV---LINIPWFAWAFLKM---MYPFLDPATKAKAIFDEPFENHIEPS----- 283

  Fly   131 EIYHFSSMAMEVIALENDYASLAGICEII--DL-EGVNSDKMRRFDRVL 176
                      ::.||.|.........|:.  |: :.|:..:::||||.|
Yeast   284 ----------QLDALYNGLLDFKYKHEVYWPDMVKKVDDLRLKRFDRFL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 6/45 (13%)
CRAL_TRIO 114..248 CDD:279044 15/67 (22%)
PDR17NP_014135.1 CRAL_TRIO_N 49..115 CDD:397711
CRAL_TRIO 146..291 CDD:395525 27/146 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.