DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and SEC14

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:52/255 - (20%)
Similarity:94/255 - (36%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RTDVDFLIAFLRRCRYSLEETKRRIDR-------YFT-------HYN-------LFPEIMNNRCV 87
            |.|...|:.|||..::.::..|...:.       |.|       ||:       .:|:..:....
Yeast    52 RLDDSTLLRFLRARKFDVQLAKEMFENCEKWRKDYGTDTILQDFHYDEKPLIAKFYPQYYHKTDK 116

  Fly    88 TQRLLDINRMGVCLYPDMPKGDSRSAMFIARFGHFDPNLYMLREIYHFSSMAMEVIALENDYASL 152
            ..|.:....:|.....:|.|..|...|.        .||     ::.:.|    |:.......|.
Yeast   117 DGRPVYFEELGAVNLHEMNKVTSEERML--------KNL-----VWEYES----VVQYRLPACSR 164

  Fly   153 AG------ICEIIDLEGVNSDKMRRFDRVLFRKWWNWL-YNCSPLKVKEMYIINMPKDIQGTVMF 210
            |.      .|.|:||:|::...  .:..:.:.:..::: .|..|.::.:.||||.|.........
Yeast   165 AAGHLVETSCTIMDLKGISISS--AYSVMSYVREASYISQNYYPERMGKFYIINAPFGFSTAFRL 227

  Fly   211 LYNVLSMQVNYPIRVLKNS--EELIEHIGKESLPEEYGG------TNGHLGECVAYMEDL 262
            ....|.......|.:|.:|  :||::.|..|:||.::||      :.|.|     |:.|:
Yeast   228 FKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGGKSEVDESKGGL-----YLSDI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 7/33 (21%)
CRAL_TRIO 114..248 CDD:279044 31/148 (21%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 7/26 (27%)
SEC14 99..269 CDD:214706 37/188 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.