DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and Sec14l5

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001121197.1 Gene:Sec14l5 / 665119 MGIID:3616084 Length:696 Species:Mus musculus


Alignment Length:299 Identity:55/299 - (18%)
Similarity:104/299 - (34%) Gaps:91/299 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETK------------RRIDRYFTHYNLFPE 80
            ::.||.|: |:.|.......:.::.|||...:.|::.:            .::|.....:...|.
Mouse   246 LVQLRHWL-QETHKGKIPKDEHILRFLRARDFHLDKARDMLCQSLSWRKQHQVDLLLQTWRPPPP 309

  Fly    81 IMNNRCVTQRLLDINRMGVCLYPDMPKGDSRSAMFIARFGHFDPNLYMLREIYHFSSMAMEVIAL 145
            :.....           |...|.|:   |.| .::|.|.|..|..  .|.:.....::...|:::
Mouse   310 LQEFYA-----------GGWHYQDI---DGR-PLYILRLGQMDTK--GLMKAVGEEALLQHVLSV 357

  Fly   146 ENDYASLAGICE---------------IIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEM 195
            ..:....   ||               ::||||:|.       |.|:|.....|     |::.|:
Mouse   358 NEEGQKR---CEGNTRQFGRPISSWTCLLDLEGLNM-------RHLWRPGVKAL-----LRMIEV 407

  Fly   196 YIINMPKDIQGTVMF---------LYNVLSMQVNYPIR----VLKNSE-----ELIEHIGKESLP 242
            ...|.|:.: |.::.         |:.::|..:|...|    :...|.     .|::::.|:.:|
Mouse   408 VEDNYPETL-GRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVIP 471

  Fly   243 EEYGGTNGHLGECVAYMEDLLNSYRGYFEQDCNYGTIEE 281
            :..||            |.:.|...|.......|.|.||
Mouse   472 DFLGG------------ESVCNVPEGGMVPKSLYLTEEE 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 10/54 (19%)
CRAL_TRIO 114..248 CDD:279044 31/166 (19%)
Sec14l5NP_001121197.1 PRELI 17..173 CDD:368069
CRAL_TRIO_N 243..288 CDD:215024 9/42 (21%)
SEC14 306..479 CDD:214706 39/217 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.