DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and RLBP1

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:275 Identity:54/275 - (19%)
Similarity:105/275 - (38%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TLAKLAEQEVNETPDRIQQDIIILRVWIRQQ-----------PHLRARTDVDFLIAFLRRCRYSL 61
            ||.| |:.|:||..:..::.:..|:..::.|           .......|..|.:.|:|..::::
Human    53 TLQK-AKDELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNV 116

  Fly    62 EETKRRIDRYFTHYNLFPEIMNN------RCVTQRLLDINRMGVCLYPDMPKGDSRSAMFIARFG 120
            ......:..|......:||:.::      ||.    ::....||....|             ::|
Human   117 GRAYELLRGYVNFRLQYPELFDSLSPEAVRCT----IEAGYPGVLSSRD-------------KYG 164

  Fly   121 HFDPNLYMLREIYHFSSMAM---EVI---------ALENDYASLAGICEIIDLEGVNSDKMRRFD 173
                .:.||..|.::.|..:   |::         .|||:...:.|.|.|.:.:|....:.....
Human   165 ----RVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLR 225

  Fly   174 RVLFRKWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPI--RVLKNSEEL---I 233
            ....||..:.|.:..|.:.|.::.|:.|.....|    |||:...:...:  ||..:.::|   .
Human   226 TSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTT----YNVVKPFLKSKLLERVFVHGDDLSGFY 286

  Fly   234 EHIGKESLPEEYGGT 248
            :.|.:..||.::|||
Human   287 QEIDENILPSDFGGT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 6/56 (11%)
CRAL_TRIO 114..248 CDD:279044 31/150 (21%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145910
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.