DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and Sec14l4

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:267 Identity:54/267 - (20%)
Similarity:106/267 - (39%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRRID 69
            |||     .:||.......|.||::         |.| .:.|..||:.:||...:.|::::..:.
  Rat     8 LSP-----QQQEALTRFREILQDVL---------PTL-PKADDFFLLRWLRARNFDLKKSEDMLR 57

  Fly    70 RYFTHYNLF----------PEIMNNRCVTQRLLDINRMGVCLYPDMPKGDSRSA-MFIARFGHFD 123
            ::....|..          ||::       ||.|..  |:|.|      |.... ::....|..|
  Rat    58 KHVEFRNQQDLDHILTWQPPEVI-------RLYDSG--GLCGY------DYEGCPVWFDLIGTLD 107

  Fly   124 P-NLYM-------LREIYHFSSMAMEVIALENDY--ASLAGICEIIDLEGVNSDKMRRFDRVLFR 178
            | .|:|       :|:......|.:....|::..  ..:..:..:.|:||::...:.:....:::
  Rat   108 PKGLFMSASKQDLIRKRIKVCEMLLHECELQSQKLGRKVERMVMVFDMEGLSLRHLWKPAVEVYQ 172

  Fly   179 KWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNS--EELIEHIGKESL 241
            :::..|....|..||.:.:|..||........:.:.:.......|.:|..:  :||::.:..:.|
  Rat   173 QFFAILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLKFMSPDQL 237

  Fly   242 PEEYGGT 248
            |.|:|||
  Rat   238 PVEFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 10/45 (22%)
CRAL_TRIO 114..248 CDD:279044 26/145 (18%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 13/55 (24%)
SEC14 76..244 CDD:214706 35/182 (19%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.