DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and pinta

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster


Alignment Length:263 Identity:57/263 - (21%)
Similarity:113/263 - (42%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRRIDRYFTHYNLFPEIMNNR 85
            |:|:...:..|..|:...|.:......:.|..|||..::.:|..|:::..::.......|..:||
  Fly    19 PERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFDNR 83

  Fly    86 -CVTQRLLDINRMGVCLYPDMPKGDSRSAMFIARFGHFDPNLYMLREIYHFSSMAMEVIALENDY 149
             .....:.|:.::||.| |..|..:.|..:.|....| ||.|:....::..|.|.::::...:..
  Fly    84 DPQLPEIQDLLKLGVFL-PIGPDAEQRMVVVIRTAAH-DPKLHSQNNVFKTSKMILDLLLKLDPE 146

  Fly   150 ASLAGICEIIDLEGVN-SDKMRRFDRVLFRKWWNW-LYNCSPLKVKEMYIINMPKDIQGTVMFLY 212
            ....|:..|:|::||. ...::...:::.|...:| .|.|.|   |.:...|.|:.:.    |..
  Fly   147 TCARGMVAILDMQGVQLGHALQMNPKLIKRSVESWTAYPCQP---KLLEFTNAPRHVN----FFL 204

  Fly   213 NVLSMQVNYPIRVLKNSEELIEHIGK----ESLPEEYGGTNGHLGECVAYMEDLLNSYRGYFEQD 273
            |...:.:...||    |...:...|.    :.||:|.|      |:.::||| |...::...|::
  Fly   205 NTFRIFMTPKIR----SRLFVRREGTSVSCDQLPKELG------GQGLSYME-LSVKWKQLVEEN 258

  Fly   274 CNY 276
            .::
  Fly   259 ADF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 9/45 (20%)
CRAL_TRIO 114..248 CDD:279044 30/139 (22%)
pintaNP_001287466.1 SEC14 87..240 CDD:238099 37/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.