DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CG2663

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:325 Identity:91/325 - (28%)
Similarity:146/325 - (44%) Gaps:43/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSPTLAKLAEQEVN--------ETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSL 61
            |.||    .:|.|:        |.|..|::||.::|.|:..||||....|...|..|||.|::||
  Fly     4 LHPT----PDQRVSIREELREPEDPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSL 64

  Fly    62 EETKRRIDRYFTHYNLFPEIMNNRCVTQRLLDINR--MGVCL----YPDMP--KGDSRSAMFIAR 118
            |:.|:::|.|:|..|..||..:||       ||||  :.:.|    .|.:|  ..:.|...||..
  Fly    65 EKVKKKLDMYYTMRNAVPEFFSNR-------DINREELNIVLDYVHCPTLPGITPNGRRITFIRG 122

  Fly   119 FG-HFDPNLYMLREIYHFSSMAMEV------IALENDYASLAGICEIIDLEGVNSDKMRRFDRVL 176
            .. .|.|         |....||:|      :.|..:...:||...|:|....::....:|...:
  Fly   123 IDCDFQP---------HHILDAMKVALMIGDVRLAEESVGIAGDIFILDASVASAAHFAKFSPTV 178

  Fly   177 FRKWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEHIGKESL 241
            .:|:...:....|:||||:::||:...:.....|:...:..::...|....:.|.|.:.:.::.|
  Fly   179 VKKFLIAVQEAYPVKVKEVHVINISPLVDTIFNFVKPFVKEKIRSRITFHNDVESLYKVVPRDLL 243

  Fly   242 PEEYGGTNGHLGECVAYMEDLLNSYRGYFEQDCNYGTIEELRHGEIATYEAEFGANGSFRRLNWD 306
            |.||||..|.:.|...:.:..|.....:|:...:....|.||.|...|.:..||..|:||:||.|
  Fly   244 PNEYGGKAGGVVELNQWWKQKLVDNTQWFKDQEDKKANESLRPGAPKTSDDLFGMEGTFRQLNID 308

  Fly   307  306
              Fly   309  308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 19/45 (42%)
CRAL_TRIO 114..248 CDD:279044 31/140 (22%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 19/45 (42%)
SEC14 95..250 CDD:238099 35/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.020

Return to query results.
Submit another query.