DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and Cralbp

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:331 Identity:72/331 - (21%)
Similarity:140/331 - (42%) Gaps:46/331 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLR-ARTDVDFLIAFLRRCRYSLEETKRRI 68
            |...|.|:|::|:.|.....:|.:..||.|:.:...|: .|.|..||:.|||..::|:...::.:
  Fly    11 LPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTL 75

  Fly    69 DRYFTHYNLFPEIMNNRCVTQ------RLLDINRMG-VCLYPDMPKGDSRSAMFIARFGHFDPNL 126
            .:|......||.:.     ||      ||.|:...| :...|...|...|..:..|:  ..:|.:
  Fly    76 LKYLNIRRTFPHMS-----TQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAK--GLNPKI 133

  Fly   127 YMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLK 191
            :...:......:..|.: :|:....:.|:..:.|..||.:..:..::...|.:.:.|.....|::
  Fly   134 HTSCDQAKAHFLTYECL-MEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMR 197

  Fly   192 VKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEHIGKESLPEEYGG--------- 247
            .||:::||:|..::..:.|:.|.:|.::...:.:..:.:||::.:.:..||.|.||         
  Fly   198 HKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGKVPMREMIE 262

  Fly   248 -------TNGHLGECVAYMEDLLNSYRGYFEQDCNYGTIEELRHGEIATYEAEF-----GANGSF 300
                   |...|  .:...:.:|.|.||...:       .....|:.:|....|     ...|||
  Fly   263 LWKQELATKRDL--ILGLDKSILRSDRGIQRR-------SSFNAGKASTGGPNFVSQIESIEGSF 318

  Fly   301 RRLNWD 306
            |:|.:|
  Fly   319 RKLEFD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 13/46 (28%)
CRAL_TRIO 114..248 CDD:279044 26/149 (17%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 13/46 (28%)
SEC14 101..254 CDD:238099 30/155 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.