DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and Sec14l3

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:289 Identity:64/289 - (22%)
Similarity:105/289 - (36%) Gaps:96/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSP----TLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETK 65
            |||    ||||..|.         .||::         |.| ...|..||:.:||...:.|::::
Mouse     8 LSPKQAETLAKFREN---------VQDVL---------PAL-PNPDDYFLLRWLRARNFDLQKSE 53

  Fly    66 RRIDRYFTHYNLFPEIMNNRCVTQRLLDINRM---------------GVCLY------------- 102
            ..:.:|...              ::.:||:.:               |:|.|             
Mouse    54 AMLRKYMEF--------------RKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIG 104

  Fly   103 PDMPKGDSRSAMF-IARFGHFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNS 166
            |..|||    .:| :.:.......:.....|.|...:..|.:.     ..:..|..|.|.||:. 
Mouse   105 PLDPKG----LLFSVTKQDLLKTKMRDCERILHECDLQTERLG-----RKIETIVMIFDCEGLG- 159

  Fly   167 DKMRRFDRVL---FRKWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFL--YNV----LSMQVNYP 222
              ::.|.:.|   :::::..|....|..:|.|.|      ::.|.:|.  ||:    ||......
Mouse   160 --LKHFWKPLVEVYQEFFGLLEENYPETLKFMLI------VKATKLFPVGYNLMKPFLSEDTRRK 216

  Fly   223 IRVL-KNS--EELIEHIGKESLPEEYGGT 248
            |.|| .||  |.|::.|..|.||..:|||
Mouse   217 IVVLGSNSWKEGLLKLISPEELPAHFGGT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 10/45 (22%)
CRAL_TRIO 114..248 CDD:279044 34/146 (23%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 15/64 (23%)
SEC14 76..246 CDD:214706 43/188 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.