DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and Clvs2

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:260 Identity:59/260 - (22%)
Similarity:101/260 - (38%) Gaps:61/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLR-ARTDVDFLIAFLRRCRYSLEETKRRI 68
            |||...:.|..|:||.||.:.|||..:|..:..:|.:. .|||..|::.|||..::...|..|.:
  Rat     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72

  Fly    69 DRYFTHYNLFPEIMNNRCVTQRLLDINRM------GV--CLYPDMPKG----DSRSAMFIARF-G 120
            .:||.:             .|:.||:.:.      |:  .|....|.|    |......:..| .
  Rat    73 AQYFEY-------------RQQNLDMFKSFKATDPGIKQALKDGFPGGLANLDHYGRKILVLFAA 124

  Fly   121 HFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLY 185
            ::|.:.|.|.:|.....:::|.: :|:....:.|...|||                   |.|:.:
  Rat   125 NWDQSRYTLVDILRAILLSLEAM-IEDPELQVNGFVLIID-------------------WSNFTF 169

  Fly   186 NCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYP-----IRVLKNSEELIEHIGKESLPEEY 245
            ..:......|    :...|:|..:.:|:.....|:|.     :|:|.|.     ...|.|.|:.|
  Rat   170 KQASKLTPSM----LRLAIEGLQVRVYHCYCFFVSYMLFALYVRILDNL-----WTNKTSKPKGY 225

  Fly   246  245
              Rat   226  225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 14/46 (30%)
CRAL_TRIO 114..248 CDD:279044 26/138 (19%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 14/45 (31%)
SEC14 103..>204 CDD:301714 22/124 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.