DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CG10237

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:292 Identity:66/292 - (22%)
Similarity:125/292 - (42%) Gaps:57/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KLAEQEVNETPDR---IQQDIIILRVWIRQQPHLRARTDV-------DFLIAFLRRCRYSLEETK 65
            ::|.:|:.|||:|   ..:::..|         |.|.||:       ::||.:||.|:|..|..:
  Fly    54 EVAIKELRETPERQKEASKELARL---------LEAETDLLYPKGNEEWLIRYLRPCKYYPESAR 109

  Fly    66 RRIDRYFT----HYNLFPEIMNNRCVTQRLLDINRMGVCLYPDMPKGDSRSAMFIA-----RFGH 121
            ..|.||:.    |.:::.::..:.  ...:...|.:.|     .|..|......:.     |:.|
  Fly   110 DLIKRYYAFKVKHADVYTDLKPSN--EANIFKHNILTV-----FPNRDQLGRRILVLELGKRWKH 167

  Fly   122 FDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYN 186
               ....|.|::..:.:.:|...||.: ..:.|...|.|::|::..:..:|.....::..:||.:
  Fly   168 ---KQVTLDEVFKGAVLFLEAAMLEPE-TQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWLQD 228

  Fly   187 CSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVL---KNSEELIEHIGKESLPEEYGGT 248
            ..||::|.::|:|.||..|  |:|......::.....|::   .:.|.|.:::..:.||..|||.
  Fly   229 SVPLRIKAIHIVNQPKIFQ--VVFALFKPFLKEKLRSRIIFHGTDRESLHKYMSPKCLPAAYGGF 291

  Fly   249 NGH-----------LGECVAYMEDLLNSYRGY 269
            ...           |.:|.... |.:||| ||
  Fly   292 REASRIDSDQWYQLLLKCDTEF-DTINSY-GY 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 13/52 (25%)
CRAL_TRIO 114..248 CDD:279044 31/141 (22%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 13/55 (24%)
SEC14 137..290 CDD:238099 34/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447127
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.850

Return to query results.
Submit another query.