DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CG5973

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:304 Identity:69/304 - (22%)
Similarity:133/304 - (43%) Gaps:57/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRRPLSPTLA-KLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEET 64
            |.:..:|..| |.|:.|:.|.|...:|.|..||..|:.:.:|....|.::::.|||...|..|..
  Fly    26 MEKEQAPEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESA 90

  Fly    65 KRRIDRYFTHY---------NLFPEIMNNRCVTQRLLDINRMGVCLYPDMPKGD--SRSAMFIAR 118
            .:|:..:: |.         |:.|..:.|      :.:.|.:.:     :|:.|  .|..:.:..
  Fly    91 LKRLKNFY-HMKLKYGAACENIIPSKLRN------VFEANILNL-----LPQRDQHGRRLLVLEA 143

  Fly   119 FGHFDPNLYMLREIYHFSSMAMEVI-ALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWN 182
            ...:.|:...|.::  |..:.:.|: ::...|:.:.|...|||:||:....:.:|.........:
  Fly   144 GKKWKPSQVPLVDL--FRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLD 206

  Fly   183 WLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPI-------RVL---KNSEELIEHIG 237
            ::..|..:::|.::|:|.        .:::|:| ..|..|.       |:.   |:.:.||.||.
  Fly   207 YIQECICMRLKAVHIVNN--------SYIFNML-FAVFKPFIREKLRKRIFFHGKDYKSLISHIE 262

  Fly   238 KESLPEEYGGTN----------GHLGECVAYMEDLLNSYRGYFE 271
            .::||.:|||:.          |...||.:...:|.:|| ||.|
  Fly   263 AKALPPKYGGSATWELPHGKVLGEFFECYSKDYELADSY-GYTE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 13/45 (29%)
CRAL_TRIO 114..248 CDD:279044 30/144 (21%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 13/44 (30%)
SEC14 116..272 CDD:238099 34/177 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.