DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CG5958

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:264 Identity:57/264 - (21%)
Similarity:108/264 - (40%) Gaps:40/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRY----SLEETK 65
            |.|...::|..|:.||.:...:.||.||..::..|.|..:.|..||..|||.|.:    :||:.|
  Fly    18 LKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMK 82

  Fly    66 RRIDRYFTHY-----NLFPEIMNNRCVTQRLLDINRMGVCLYPDMPKGDSRS-AMFIARFGH-FD 123
            .... :...|     .|..|.:..:.|...::::          :...|.:. .:.|...|. :|
  Fly    83 TTAS-FRKEYASLVRGLLVEQVKEKFVKGSVINV----------LKNCDQKGRRVLIVNCGKLWD 136

  Fly   124 PNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCS 188
            |:.....|::....|......||.: ..:.|:..|:|.||::..:::.......::...::....
  Fly   137 PSDITSDEMFRMLYMVHLAAQLEEE-TQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAM 200

  Fly   189 PLKVKEMYIINMPKDIQGTVMFLYN-VLSMQVNYPIRVLKN--------SEELIEHIGKESLPEE 244
            ||::||::.:..|        |::| |.|:...:..:.|.|        .:.|.:.:....||..
  Fly   201 PLRMKEVHFVKQP--------FIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPAN 257

  Fly   245 YGGT 248
            |.||
  Fly   258 YKGT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 16/49 (33%)
CRAL_TRIO 114..248 CDD:279044 28/143 (20%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 15/43 (35%)
CRAL_TRIO 111..261 CDD:279044 29/168 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.