DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CG31826

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:281 Identity:71/281 - (25%)
Similarity:110/281 - (39%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRRIDRYFTHYNLFPEI 81
            |:.|.::|.: |..||..:.:...||..|:...|..||...|:...:..:.|..|:......|  
  Fly     8 VDHTAEQIFK-IEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHP-- 69

  Fly    82 MNNRCVTQRLLDINRM---GV-CLYPDMPKGDSRSAMFIARFGHFD-----PNLYMLREIYHFSS 137
               ..|.:..::..|.   |. |.|. ||:.| ||...:..|...|     |:  .|:.:.....
  Fly    70 ---TWVARHPIEHYRQLFYGTHCRYV-MPQAD-RSGRVLVVFKTVDGFQDYPD--YLQSLVEMDD 127

  Fly   138 MAMEVIAL-----ENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMYI 197
            :..|.:.|     :|      ||..|.||:|.|.:.:|:|... |.|..|......|...:.::|
  Fly   128 LIFESLLLLPRVQQN------GITVICDLQGTNRNFLRQFSPA-FMKVVNEKNGVLPFSQRIVHI 185

  Fly   198 INMPKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEH-----------IGKESLPEEYGG---- 247
            |.     :|.:|.:.:.|.|    |....:..|::..|           :|.||||.||||    
  Fly   186 IQ-----RGFLMHVTSTLFM----PFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATN 241

  Fly   248 ---TN---GHLGECVAYMEDL 262
               ||   .||.:...|:|.|
  Fly   242 VLDTNLIFNHLSQNAEYLEKL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 11/45 (24%)
CRAL_TRIO 114..248 CDD:279044 38/161 (24%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 11/44 (25%)
CRAL_TRIO 92..237 CDD:279044 41/164 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.