DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CG3823

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:301 Identity:67/301 - (22%)
Similarity:112/301 - (37%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRRIDRYFT 73
            |.:.||.::..|  ||..    |:.|::.||.|........|..||...|..|...:|.::..:.
  Fly     4 LNEKAEDQLMTT--RISD----LQDWLQAQPQLPQNISRLLLRRFLHTTRGDLSAAQRLLELNYG 62

  Fly    74 HYNLFPEIMNNR----CVTQRLLDINRMGVCLYPDMPKGDSRSAMFIARFGHFDPNLY-MLREIY 133
            ..|....|..:|    ..:|:||.:    ..|.|........:.:...|...||.:.: ....|.
  Fly    63 LRNKHAHIFIDRDPLDASSQQLLQV----ADLVPLPGLTPENNKLLFYRLIDFDADKFNFTAAIK 123

  Fly   134 HFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMYII 198
            .|..:|....|.||:.....|...:.|:.|.....:.:......|.:..::....|:::||::::
  Fly   124 VFFMVADCRFATENEERLSDGEIPVFDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVL 188

  Fly   199 NMPKDIQGTVMFLYNVLSMQVNYPIRV-LKNSEELIEHIGKESLPEEYGGTNGHLGECVAYMEDL 262
            |.|..:...:..:...:..:|...|.. |.|::....|..:..|||||||..|.:.:.......|
  Fly   189 NCPSYVDKVMAVVKPFIKGEVFKLIHFHLPNADTPYRHFPRSMLPEEYGGEAGKMSDLKLQWMQL 253

  Fly   263 LNSYRGYFEQDCNY----------------GTIEELRHGEI 287
            |...|.|.....|:                |..|.||..||
  Fly   254 LKEQRDYLMDTENWQINKIKKNGQRKSSDSGVTEGLRSLEI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 11/45 (24%)
CRAL_TRIO 114..248 CDD:279044 29/135 (21%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 31/148 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447103
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.