DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CG3191

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:310 Identity:68/310 - (21%)
Similarity:123/310 - (39%) Gaps:48/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SPTLAKLAEQEVNETPDRI----QQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRY-SLEETK 65
            |.|..:|..::.::|.::.    ::|:..|..|.||...|....| ..|:....:|.: .:|||:
  Fly    12 SGTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEID-PLLLRRFYQCMFGDVEETR 75

  Fly    66 RRIDRYFTHYNLFPEIMNNR----CVTQRLLD----INRMGVCLYPDMPKGDSRSAMFIARFGHF 122
            :.|:..:...|..|.:...|    ..::|..|    :...|  |.||..|               
  Fly    76 KLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPG--LTPDKCK--------------- 123

  Fly   123 DPNLYMLRE-----IYH------FSSMAMEVIALENDYAS----LAGICEIIDLEGVNSDKMRRF 172
             .:||..||     ::|      |..::.......:|.|.    ..|..:|.|::|.....:.|.
  Fly   124 -VSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRL 187

  Fly   173 DRVLFRKWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNS-EELIEHI 236
            .....|.:..:|....|::::.:::||.|..:...|..:...:|.:|...||....| ..|.|.:
  Fly   188 TISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFV 252

  Fly   237 GKESLPEEYGGTNGHLGECVAYMEDLLNSYRGYFEQDCNYGTIEELRHGE 286
            .:|.|||||||..|.|.....:.:..|..:|.|.....::..::..:..|
  Fly   253 PREMLPEEYGGGAGSLEALRTHTQKALVEHRDYLMDPDHWVVVKPEKRNE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 13/46 (28%)
CRAL_TRIO 114..248 CDD:279044 34/149 (23%)
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447094
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.