DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and SEC14L4

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_016884276.1 Gene:SEC14L4 / 284904 HGNCID:20627 Length:465 Species:Homo sapiens


Alignment Length:267 Identity:50/267 - (18%)
Similarity:105/267 - (39%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRRIDRYFTH 74
            |.|...||...|..|:......|..::....:....|..||:.:||...:.|::::..:.|:...
Human    57 AGLVAPEVMRAPPTIRSSSAQFRENLQDLLPILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEF 121

  Fly    75 Y------NLF----PEIMNNRCVTQRLLDINRMGVCLYPDMPKGDSRSA-MFIARFGHFDPNLYM 128
            .      |:.    ||::       :|.|..  |:|.|      |.... ::....|..||...:
Human   122 RKQQDLDNIVTWQPPEVI-------QLYDSG--GLCGY------DYEGCPVYFNIIGSLDPKGLL 171

  Fly   129 LRE---------------IYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFR 178
            |..               :.|...:..:.:..:.:.|.:     :.|:||::...:.:....:::
Human   172 LSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALM-----VFDMEGLSLKHLWKPAVEVYQ 231

  Fly   179 KWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNS--EELIEHIGKESL 241
            ::::.|....|..:|.:.:|..||........:.:.:|.:....|.:|.::  :||.:.|..:.|
Human   232 QFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQL 296

  Fly   242 PEEYGGT 248
            |.|:|||
Human   297 PVEFGGT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 7/45 (16%)
CRAL_TRIO 114..248 CDD:279044 25/150 (17%)
SEC14L4XP_016884276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.