DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and SEC14L3

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:288 Identity:63/288 - (21%)
Similarity:106/288 - (36%) Gaps:95/288 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSP----TLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETK 65
            |||    ||||..|.         .||::         |.| ...|..||:.:||...:.|::::
Human     8 LSPKQAETLAKFREN---------VQDVL---------PAL-PNPDDYFLLRWLRARNFDLQKSE 53

  Fly    66 RRIDRYFTHYNLFPEIMNNRCVTQRLLDINRM---------------GVCLY------------- 102
            ..:.:|...              ::.:||:.:               |:|.|             
Human    54 ALLRKYMEF--------------RKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIG 104

  Fly   103 PDMPKGDSRSAMF-IARFGHFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNS 166
            |..|||    .:| :.:.......:.....|.|...:..|.:.     ..:..|..|.|.||:. 
Human   105 PLDPKG----LLFSVTKQDLLKTKMRDCERILHECDLQTERLG-----KKIETIVMIFDCEGLG- 159

  Fly   167 DKMRRFDRVL---FRKWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFL--YNV----LSMQVNYP 222
              ::.|.:.|   :::::..|....|..:|.|.|      ::.|.:|.  ||:    ||......
Human   160 --LKHFWKPLVEVYQEFFGLLEENYPETLKFMLI------VKATKLFPVGYNLMKPFLSEDTRRK 216

  Fly   223 IRVLKNS--EELIEHIGKESLPEEYGGT 248
            |.||.|:  |.|::.|..|.||.::|||
Human   217 IIVLGNNWKEGLLKLISPEELPAQFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 10/45 (22%)
CRAL_TRIO 114..248 CDD:279044 33/145 (23%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 15/64 (23%)
SEC14 76..245 CDD:214706 42/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.