DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and R03A10.5

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:341 Identity:61/341 - (17%)
Similarity:124/341 - (36%) Gaps:100/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAKLAEQEVNETPDRIQQDIIILRVWIRQQPH-----------------LRARTDVDFLIAFLRR 56
            |.:|.:.:::|   ....|..||| |:  |.|                 |||..::|.|      
 Worm    19 LRELVKDDISE---YYNTDFNILR-WL--QGHNTLPIEEIARKMKFHLNLRAAWNLDEL------ 71

  Fly    57 CRYSLEETKRRIDRYFTHYNLFPE-IMNNRCVTQRLLDINRMGVCLYPDMPKGDSRSAMFIARFG 120
               ..:|....|.:::.:....|. .|:|     .:::|.:.|...|..|.  ::.|.:.:.|..
 Worm    72 ---HKKERNHPIHKHWKYGITGPSGHMDN-----VIVNIEQCGKTDYTGMM--ETYSILEVMRAR 126

  Fly   121 HFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVL--FRKWWNW 183
            ..|     |.::.|      .|:.||......|.|..::|:.|:..:| :.:|.|.  .:...::
 Worm   127 MVD-----LEQMLH------HVMELEAKTGKQAWILYVMDITGLQYNK-KLYDLVTGSMKSLADF 179

  Fly   184 LYN------------CSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNS---EELI 233
            :.:            |.|.....:|::..|            :|..:....:|::..:   ::::
 Worm   180 MADHYVEMIKYFVPVCVPSFATALYVVVRP------------LLPEKTREKVRLIGETNWRDDVL 232

  Fly   234 EHIGKESLPEEYGGTN----GHLGECVAYMEDLLNSYRGYFEQDCNYGTIEELR-----HGEIAT 289
            ::....|||..:...|    |.:...:.|..|      ||:... |:..::..:     :|:|..
 Worm   233 QYAIHSSLPSIWNNENHTFGGFIELPIGYPTD------GYYSAK-NHSVVKNAQTVNVPYGKIHV 290

  Fly   290 YEAEFGANGSFRRLNW 305
            ......|.   |:|.|
 Worm   291 VTKFIKAG---RKLRW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 14/62 (23%)
CRAL_TRIO 114..248 CDD:279044 23/150 (15%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 32/202 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.