DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and ctg-2

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:145 Identity:38/145 - (26%)
Similarity:65/145 - (44%) Gaps:21/145 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GHFD----------PNLYMLREIYHFSSMAMEVI-ALENDYASLAGICEIIDLEGVNSDKMRRFD 173
            ||.|          .:||.:|  ...|...|::| .:|.:.....|...|.||:|::   |.:.|
 Worm   126 GHLDAAGLMPATRNSDLYRMR--IAESEGVMQIIRKMEKEQGKPLGTSVIFDLDGLS---MVQID 185

  Fly   174 RVLFR---KWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKN--SEELI 233
            ....:   ...:.|....|..:::::|:|.|..||.....:...|:.|....:::|.|  .:.|.
 Worm   186 LAALKVVTTMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQKVKILGNDWKQHLK 250

  Fly   234 EHIGKESLPEEYGGT 248
            |:||:|.|.|.:|||
 Worm   251 ENIGEEVLFERWGGT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024
CRAL_TRIO 114..248 CDD:279044 36/143 (25%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 38/145 (26%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.