DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and CLVS1

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:292 Identity:64/292 - (21%)
Similarity:103/292 - (35%) Gaps:95/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLR-ARTDVDFLIAFLRRCRYSLEETKRRI 68
            |||...:.|..|:||.||.:.|||..:|..|..:|.:. .|||..|::.|||..::...:..|.:
Human    30 LSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARKFHQADAFRLL 94

  Fly    69 DRYFTHYNL----------------------FPEIMNNRCVTQRLLDINRMGVCLYPDMPKGDSR 111
            .:||.:..|                      ||.::.||                       |..
Human    95 AQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENR-----------------------DHY 136

  Fly   112 SAMFIARF-GHFDPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIID--------------- 160
            ....:..| .::|.:.....:|.....:::||: :|:....:.|...|||               
Human   137 GRKILLLFAANWDQSRNSFTDILRAILLSLEVL-IEDPELQINGFILIIDWSNFSFKQASKLTPS 200

  Fly   161 -----LEGVNSDKMRRFDRVLF--RKWWNWLYNCSPLKVKEMYIINMP--KDIQGTVMFLYNVLS 216
                 :||:......||..|.|  :.|:          :..:|.:..|  ||.....:||:.   
Human   201 ILKLAIEGLQDSFPARFGGVHFVNQPWY----------IHALYTLIKPFLKDKTRKRIFLHG--- 252

  Fly   217 MQVNYPIRVLKNSEELIEHIGKESLPEEYGGT 248
                      .|...|.:.|..|.||.|:|||
Human   253 ----------NNLNSLHQLIHPEFLPSEFGGT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 14/46 (30%)
CRAL_TRIO 114..248 CDD:279044 31/158 (20%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 14/45 (31%)
CRAL_TRIO 125..274 CDD:306996 36/195 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145886
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.