DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and Sec14l4

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:227 Identity:45/227 - (19%)
Similarity:91/227 - (40%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RTDVDFLIAFLRRCRYSL---EETKRRIDRYFTHYNL-------FPEIMNNRCVTQRLLDINRMG 98
            :.|..||:.:||...:.|   |:..|:...:....||       .||::       :|.|...:.
Mouse    32 KADDYFLLRWLRARNFDLKKSEDMLRKHVEFRNQQNLDQILTWQAPEVI-------QLYDSGGLS 89

  Fly    99 VCLYPDMPKGDSRSAMFIARFGHFDP-NLY-------MLREIYHFSSMAMEVIALENDY--ASLA 153
            ...|...|       ::....|..|| .|:       |:|:......|.:....|::..  ..:.
Mouse    90 GYDYEGCP-------VWFDIIGTMDPKGLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIE 147

  Fly   154 GICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQ 218
            .:..:.|:||::...:.:....::::::..|....|..||.:.||..||........:.:.:..:
Mouse   148 RMVMVFDMEGLSLRHLWKPAVEVYQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEE 212

  Fly   219 VNYPIRVLKNS--EELIEHIGKESLPEEYGGT 248
            ....|.:|..:  :||::.:..:.||.|:|||
Mouse   213 TQKKIVILGGNWKQELVKFVSPDQLPVEFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 8/29 (28%)
CRAL_TRIO 114..248 CDD:279044 27/145 (19%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 8/26 (31%)
SEC14 77..244 CDD:214706 33/180 (18%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.