DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10301 and clvs2

DIOPT Version :9

Sequence 1:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_017949794.1 Gene:clvs2 / 100496225 XenbaseID:XB-GENE-1005080 Length:327 Species:Xenopus tropicalis


Alignment Length:268 Identity:62/268 - (23%)
Similarity:106/268 - (39%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLR-ARTDVDFLIAFLRRCRYSLEETKRRI 68
            |||...:.|..|:||.||.:.|||..:|..:..:|.:. .|||..|::.|||..:::..|..|.:
 Frog     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFNHFEAFRLL 72

  Fly    69 DRYFTHYNLFPEIMNNRCVTQRLLDINRMGVCLYPDMPKG--DSRSAMFIARFGHF--------- 122
            .:||.:             .|:.||:.:......|.:.:|  |....: ::...||         
 Frog    73 AQYFEY-------------RQQNLDMFKNFKATDPGIKQGLKDGFPGV-LSNLDHFGRKILVLFA 123

  Fly   123 ---DPNLYMLREIYHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWL 184
               |.:.|.|.:|.....:::|.: :|:....:.|...|||.......:..:....:.|.....|
 Frog   124 ANWDQSRYTLVDILRAILLSLEAM-IEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGL 187

  Fly   185 YNCSPLKVKEMYIINMPKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEH----------IGKE 239
            .:..|.:...::.:|.|..|..    ||.|:.     |....|..:.:..|          |..|
 Frog   188 QDSFPARFGGIHFVNQPWYIHA----LYTVIR-----PFLKEKTRKRIFLHGNNLNSLHQLIHPE 243

  Fly   240 SLPEEYGG 247
            .||.|:||
 Frog   244 ILPSEFGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 14/46 (30%)
CRAL_TRIO 114..248 CDD:279044 31/156 (20%)
clvs2XP_017949794.1 CRAL_TRIO_N 29..75 CDD:215024 14/45 (31%)
SEC14 106..251 CDD:238099 29/155 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.