DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VAChT and LOC101731380

DIOPT Version :9

Sequence 1:NP_477138.1 Gene:VAChT / 42795 FlyBaseID:FBgn0270928 Length:578 Species:Drosophila melanogaster
Sequence 2:XP_031755164.1 Gene:LOC101731380 / 101731380 -ID:- Length:414 Species:Xenopus tropicalis


Alignment Length:391 Identity:142/391 - (36%)
Similarity:230/391 - (58%) Gaps:38/391 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 QDSATGILFASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSVLFFARSL 157
            ::...|:|.|||||||::.||....:..::||:|||:.|..|...|..:||..||||:||.||||
 Frog    55 ENITVGLLLASKAIVQILFNPIVSLITYRLGYELPMIFGFIITLPSILLFAFASSYSLLFVARSL 119

  Fly   158 QGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILA 222
            ||.|::|...:|:|::|:::|::.||.:|:||||..::.|.:..||||.|:|.|.||..||||||
 Frog   120 QGIGTSFTSVSGMAILANKYTDDKERGEAMGIALGGVALGLVAGPPFGSAMYAFVGKASPFLILA 184

  Fly   223 LVCLLDGLMLLLVMKPVKEAMKQSKDVQDQVIPI-------WRLLMDPYIAVCAGALTMSNVALA 280
            .:.||||.:.||::.|.|.|            |:       ..||.||||.:.||::.::|:.:|
 Frog   185 ALTLLDGALRLLILTPSKTA------------PLTIAAPAFCALLKDPYIVLAAGSICLTNMVIA 237

  Fly   281 FLEPTISLWMEDNMTTDNWKIGMVWLPAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFSC 345
            ..|||:.:||...|.|.:|.:|:|:.||...:::...:..::::|.  .:||.:..|:.|.|.|.
 Frog   238 MAEPTLPVWMLGTMCTPDWLLGIVFFPASISYLVCTNLLPRLSQKI--GRWLCSLLGMVLAGISF 300

  Fly   346 FIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSIAYAVGP 410
            ..:|....:..|:.||......|.::|.:::|.:.||||:|:.||||.:|||:||:.::.:||||
 Frog   301 LCVPLAVNFYGLITPIAAFGISIGMVDVSMVPLMAYLVDLRHSSVYGGVYAISDIALNLGFAVGP 365

  Fly   411 IIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRNIYDFKPFENEANILMQDPPNKEYQTYVMHD 475
            .:||...:|||...|..:||..|:.|.|:.                 ||:::||.|..:..:::.
 Frog   366 CVAGITAKAIGLPWLMVIIAVLNIMYSPLC-----------------ILLRNPPGKSEKMAILNK 413

  Fly   476 Q 476
            :
 Frog   414 E 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VAChTNP_477138.1 MFS_1 88..410 CDD:284993 124/323 (38%)
2_A_01_02 98..238 CDD:273318 68/139 (49%)
LOC101731380XP_031755164.1 MFS_SLC18A1_2_VAT1_2 54..399 CDD:340942 139/374 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59108
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000700
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.