DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10252 and cimap1c

DIOPT Version :10

Sequence 1:NP_651171.1 Gene:CG10252 / 42794 FlyBaseID:FBgn0039104 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_017952625.2 Gene:cimap1c / 100487571 XenbaseID:XB-GENE-6037717 Length:253 Species:Xenopus tropicalis


Alignment Length:41 Identity:13/41 - (31%)
Similarity:20/41 - (48%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SQPSRALYIFLSTNKIPFDRCPIALRKMQHKTDEYRRQVNR 53
            ||.||:|.:.|.    .....|....|:||:|.:..:|.:|
 Frog   953 SQLSRSLSVSLE----GLSELPTEGSKLQHQTRDRPKQQSR 989

Return to query results.
Submit another query.