DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and UBC9

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_010219.1 Gene:UBC9 / 851495 SGDID:S000002222 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:30/138 - (21%)
Similarity:64/138 - (46%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1143 VRAYEDRMDLM--SVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCHYISYCTDRLNPNLYEGG 1205
            |:..:..|||.  ...:.|.:.|.:...::....::..:||..||   .:.:.....:||:|..|
Yeast    29 VKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPP---KVKFPAGFYHPNVYPSG 90

  Fly  1206 RVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVDEPYYNEAGYEKQRGTQLGNENSRVYNE 1270
            .:|:|:|     .:::.|.|:.|:.|:::.:|.|:  |.|..|....|.  ..:..:.|...|::
Yeast    91 TICLSIL-----NEDQDWRPAITLKQIVLGVQDLL--DSPNPNSPAQEP--AWRSFSRNKAEYDK 146

  Fly  1271 MAIIKIAQ 1278
            ..:::..|
Yeast   147 KVLLQAKQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 29/130 (22%)
UBC9NP_010219.1 COG5078 1..157 CDD:227410 30/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.