DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and Ube2b

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:XP_006246405.1 Gene:Ube2b / 81816 RGDID:708345 Length:180 Species:Rattus norvegicus


Alignment Length:170 Identity:47/170 - (27%)
Similarity:80/170 - (47%) Gaps:19/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1110 ISNLITPANKAQYQRAVQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDF 1174
            :.::.|||     :|.:.|::..|:...|.||.....|:.:...:.::.||:.||:::..|....
  Rat    26 LRSMSTPA-----RRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVI 85

  Fly  1175 QFGRDYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGL 1239
            :|..:||..||...::|   ...:||:|..|.:|:.:|       ...|||:..:..:|.|||.|
  Rat    86 EFSEEYPNKPPTVRFLS---KMFHPNVYADGSICLDIL-------QNRWSPTYDVSSILTSIQSL 140

  Fly  1240 ILVDEPYYNEAGYEKQRGTQLGNENSRVYNEMAIIKIAQS 1279
            :  |||..|...  ..:..||..||.|.|.:.....:.||
  Rat   141 L--DEPNPNSPA--NSQAAQLYQENKREYEKRVSAIVEQS 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 41/145 (28%)
Ube2bXP_006246405.1 UQ_con 36..173 CDD:395127 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.