DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and ube2z

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_001007969.2 Gene:ube2z / 493338 XenbaseID:XB-GENE-990986 Length:313 Species:Xenopus tropicalis


Alignment Length:211 Identity:64/211 - (30%)
Similarity:101/211 - (47%) Gaps:39/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 VLPNAPAAHNFI----------------SNLITPANKAQY--QRA-------VQREYLMLKSSLP 1138
            :||.|.|....:                |::..|...|.:  :||       ::|:.:.:....|
 Frog    11 ILPGAAAGGGVLPHLSGLQAPGTSPLTTSSVWDPTASADWDNERASNQCVLRIKRDIMSIYKEPP 75

  Fly  1139 NGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCHYIS--YCTDRLNPNL 1201
            .|:.|......|..:..::.||..|||:...|.|.|:...|||..||....::  ..|.|.|||.
 Frog    76 PGMFVVPDPHDMTKIHALITGPFDTPYEGGFFLFLFRCPPDYPIHPPRVKLMTTGNNTVRFNPNF 140

  Fly  1202 YEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVDEPYYNEAGYEKQRGTQLGNENSR 1266
            |..|:||:|:||||.|   ..|||:.::..||:|||.| :.:.||:||.|:|::|    .:.:|:
 Frog   141 YRNGKVCLSILGTWTG---PAWSPAQSLSSVLISIQSL-MTENPYHNEPGFEQER----HSGDSK 197

  Fly  1267 VYNEMAIIKIAQSTVK 1282
            .|||.    |...|::
 Frog   198 NYNEC----IRHETIR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 53/147 (36%)
ube2zNP_001007969.2 UBCc 62..207 CDD:238117 54/156 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..313
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1047
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.