DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and vih

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:167 Identity:37/167 - (22%)
Similarity:62/167 - (37%) Gaps:56/167 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1136 SLP----NGVVVRAYEDRMDLMSV-------------------MMVGPKRTPYQNALFFFDFQFG 1177
            |:|    :.|..|.:::.|:||..                   .:.||:.|.|....:.....|.
  Fly    24 SMPVKDNHAVSKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFP 88

  Fly  1178 RDYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILV 1242
            ..||.:.||..:::.|   .:||:...|.:|:.:|       .:.||....:..:|:|||.|:  
  Fly    89 NSYPYAAPVVKFLTSC---FHPNVDLQGAICLDIL-------KDKWSALYDVRTILLSIQSLL-- 141

  Fly  1243 DEP---------------------YYNEAGYEKQRGT 1258
            .||                     .|.:|.|||.:.|
  Fly   142 GEPNNESPLNAQAAMMWNDQKEYKKYLDAFYEKHKDT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 37/167 (22%)
vihNP_648582.1 COG5078 31..166 CDD:227410 29/146 (20%)
UQ_con 36..172 CDD:278603 30/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.