DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and ube2z

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_001002330.2 Gene:ube2z / 436602 ZFINID:ZDB-GENE-040718-15 Length:380 Species:Danio rerio


Alignment Length:272 Identity:77/272 - (28%)
Similarity:116/272 - (42%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1040 DGATECNTMAEDEAMEEPLNLNA-LSESLPAIDQTGPMACSSPSWSIIPD-----TPSVDENC-- 1096
            |..||....:...|......|:| |..|:|......|....:....:.|.     ||:|:...  
Zfish     3 DSVTEEANGSVGAAQGHGAQLSASLGNSIPGHSSASPPPADTGLAVVEPGMAHTITPAVESGLGV 67

  Fly  1097 ----------FQVLPN--------APAAHNFISNLITPA-----------NKAQYQ--RAVQREY 1130
                      ..|||:        .||....:|.:...:           .||..|  ..::|:.
Zfish    68 LTHAVSSTVPVAVLPSLPPGIGSGVPAGAGLLSQIHATSWDPTLSTDWDNEKASQQCILRIKRDI 132

  Fly  1131 LMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCHYIS--YC 1193
            :.:....|.|:.|......|..:..::.||..|||:...|.|.|:...|||..||....|:  :.
Zfish   133 MSIYKEPPPGMFVVPDPHDMTKIHALITGPFDTPYEGGFFLFLFRCPPDYPIHPPRVKLITTGHN 197

  Fly  1194 TDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVDEPYYNEAGYEKQRGT 1258
            |.|.|||.|..|:||:|:||||.|   ..|||:.::..||:|||.| :.:.||:||.|:|::|..
Zfish   198 TVRFNPNFYRNGKVCLSILGTWTG---PAWSPAQSISSVLISIQSL-MTENPYHNEPGFEQERHP 258

  Fly  1259 QLGNENSRVYNE 1270
                .:|:.|||
Zfish   259 ----GDSKNYNE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 54/147 (37%)
ube2zNP_001002330.2 UBCc 127..245 CDD:238117 43/121 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0895
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1047
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.