DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and CG5823

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_001262669.1 Gene:CG5823 / 42105 FlyBaseID:FBgn0038515 Length:283 Species:Drosophila melanogaster


Alignment Length:201 Identity:41/201 - (20%)
Similarity:70/201 - (34%) Gaps:60/201 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1126 VQREYLMLK---------SSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYP 1181
            ::::|:.||         ..|||.::...|         .:.||:.:||....:.....|.|::|
  Fly    19 MKQDYMRLKRDPLPYITAEPLPNNILEWHY---------CVKGPEDSPYYGGYYHGTLLFPREFP 74

  Fly  1182 KSPPVCHYISYCTDRLNPN--LYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVDE 1244
            ..||..:       .|.||  .....|:|:|:    .....:.|:|:..:..:|..:...:|...
  Fly    75 FKPPSIY-------MLTPNGRFKTNTRLCLSI----SDFHPDTWNPTWCVGTILTGLLSFMLEST 128

  Fly  1245 P---YYNEAGYEKQRGTQLGNENSRVYNEMAIIKIAQSTVKQLTNPPLIFRN-ELIEHFKEFGTE 1305
            |   ....:.|:||...|    .|..:|                     .|| ...|.|.|...|
  Fly   129 PTLGSIESSNYDKQMFAQ----KSLAFN---------------------LRNTNFCELFPEIVEE 168

  Fly  1306 LYARMR 1311
            :..|:|
  Fly   169 IKQRLR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 33/159 (21%)
CG5823NP_001262669.1 UBCc 16..129 CDD:238117 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.