DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and CG14739

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:184 Identity:37/184 - (20%)
Similarity:78/184 - (42%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1129 EYLMLKSSLP----------NGVVVRAY----EDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRD 1179
            |.|::.::||          |.::...|    :|.|..::|.:.||..:.|:..::..:....:|
  Fly     3 EQLLVNTTLPMAGRRLDRDVNRLLASGYRTTVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQD 67

  Fly  1180 YPKSPPVCHYISYCTDRLNPNL-YEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVD 1243
            ||.:.|   .:.:.|..|:||: :..|.||:::|       .:.||.|..::.:..:....:|  
  Fly    68 YPLTAP---RVRFVTKILHPNIEFITGLVCMNVL-------KQAWSSSYDLVNIFETFLPQLL-- 120

  Fly  1244 EPYYNEAGYEKQRGTQLGNENSRVYNEMAIIKIAQSTVKQLTNPPLIFRNELIE 1297
             .|.|.......|...:...:.:::.|..|:     .:|....|..:...:|:|
  Fly   121 -RYPNPHDSLNHRAAAIMKHSEQLFREHVIL-----CMKTYAMPANLPTRQLVE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 32/157 (20%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 31/162 (19%)
UQ_con 17..152 CDD:278603 29/152 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.