DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and CG17030

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:184 Identity:44/184 - (23%)
Similarity:73/184 - (39%) Gaps:47/184 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1125 AVQREYLMLKSSLPNGVVVRAYEDRMDLM----------------SVMMVGPKRTPYQNALFFFD 1173
            |.:.|.||......|..:....||:.:|.                .:|.|.|   ||....:..:
  Fly     2 AKKEEPLMDGPKRMNRELALMLEDKQNLQFRNLLVEPNNIYKWTGLLMPVAP---PYDKGAYKME 63

  Fly  1174 FQFGRDYPKSPPVCHYISYCTDRLNPNLY-----EGGRVCVSLLGTWMGRDNEVWSPSSTMLQVL 1233
            ..|..|||..||..|        :|..:|     |.|:|||.:|      :.|.|.|::.:.|||
  Fly    64 IDFPLDYPFKPPRIH--------INTRMYHLNVNERGQVCVPIL------EVEHWIPTTRIDQVL 114

  Fly  1234 VSIQGLILVDEPYYNEAGYEKQRGTQLGNENSRVYNEMAIIKIAQSTVKQLTNP 1287
            ..:  |..:::|....|.:.:..| :..|:..|.:      |:|.:.|::.:.|
  Fly   115 QVL--LATINDPQPENAWHIEMAG-EYRNDPVRFF------KMADAWVQKYSEP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 39/166 (23%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 39/171 (23%)
UQ_con 14..153 CDD:278603 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.