DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and CG10862

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_647823.1 Gene:CG10862 / 38437 FlyBaseID:FBgn0035455 Length:354 Species:Drosophila melanogaster


Alignment Length:280 Identity:60/280 - (21%)
Similarity:105/280 - (37%) Gaps:57/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   995 QMARIRKTVAVTLGKTNDNPKQEKEDVSDAEEAIEAVSQEAELANDG------------------ 1041
            |.|||....|:..|..:::.:...|:|........:|...|.|...|                  
  Fly    73 QRARIEAMAAIAAGTDSEDTEGSAEEVRSQSFFAVSVFLTARLGTPGRRATSTPAAVPSRRGRRT 137

  Fly  1042 -----ATECNTMAEDEAMEEPLNLNALSESLPAIDQTGPMACSSPSWSIIPDTPSVDEN-----C 1096
                 ||..|.......:.:...:: |:..||.:.:..||..:.       ||.|:..|     .
  Fly   138 VSISVATPSNPPVRATVIRQGSQMH-LTRGLPTVTENVPMDETF-------DTESLQSNSLVLRL 194

  Fly  1097 FQVLPNAPAAHNFISNLITPANKAQYQRAVQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPK 1161
            |::....|...:.::  ||         .::||.....:....|.......|.:......:.||.
  Fly   195 FRIESGIPTQGDPLT--IT---------RLRREISEFSTDQTEGCKAEMVGDNLFHWVATIPGPS 248

  Fly  1162 RTPYQNALFFFDFQFGRDYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPS 1226
            .|.|:...|..:..|.|:||..||   |:::.|...:.|:...||:|:.:||:       .|||:
  Fly   249 ETVYEGGRFRVEIVFPRNYPFYPP---YLAFLTKTYHCNIALSGRICLDILGS-------KWSPA 303

  Fly  1227 STMLQVLVSIQGLILVDEPY 1246
            .::.:||:||..|:....|:
  Fly   304 LSVSKVLISIMSLLADPNPH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 32/121 (26%)
CG10862NP_647823.1 COG5078 207..354 CDD:227410 34/138 (25%)
UQ_con 212..349 CDD:278603 32/122 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.