DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and Ubc10

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_477414.1 Gene:Ubc10 / 37035 FlyBaseID:FBgn0026316 Length:154 Species:Drosophila melanogaster


Alignment Length:103 Identity:30/103 - (29%)
Similarity:51/103 - (49%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1143 VRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCHYISYCTDRLNPNLYEGGRV 1207
            ::|.:|.: |....::.|...||....|..:..|..:||..||   .|::.|...:||:.|.|:|
  Fly    25 IKADDDNL-LRWTGLIVPDNPPYNKGAFRIEINFPAEYPFKPP---KINFKTRIYHPNIDEKGQV 85

  Fly  1208 CVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILVDEP 1245
            |:.::.|      |.|.|::...||:.::..||...||
  Fly    86 CLPIIST------ENWKPATRTDQVVQALVDLINDPEP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 30/103 (29%)
Ubc10NP_477414.1 UQ_con 6..144 CDD:395127 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.