DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and CG3473

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_001285937.1 Gene:CG3473 / 34849 FlyBaseID:FBgn0028913 Length:151 Species:Drosophila melanogaster


Alignment Length:157 Identity:40/157 - (25%)
Similarity:69/157 - (43%) Gaps:25/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1114 ITPANKAQYQRAVQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGR 1178
            :||       |.::....:|:..:| |:.....|.......|::.|||.:|::...|..:.....
  Fly     4 LTP-------RIIKETQRLLEDPVP-GISATPDECNARYFHVLVTGPKDSPFEGGNFKLELFLPE 60

  Fly  1179 DYPKSPPVCHYISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLILV- 1242
            |||...|   .:.:.|...:||:...||:|:.:|       .:.|||:..:..||:|||.|:.. 
  Fly    61 DYPMKAP---KVRFLTKIFHPNIDRVGRICLDIL-------KDKWSPALQIRTVLLSIQALLSAP 115

  Fly  1243 --DEPYYNEAG----YEKQRGTQLGNE 1263
              |:|..|:..    ..::|..||..|
  Fly   116 NPDDPLANDVAELWKVNERRAIQLARE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 37/145 (26%)
CG3473NP_001285937.1 UBCc 3..151 CDD:294101 40/157 (25%)
COG5078 7..149 CDD:227410 38/147 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.