DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and CG5440

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_001285558.1 Gene:CG5440 / 33318 FlyBaseID:FBgn0031331 Length:169 Species:Drosophila melanogaster


Alignment Length:163 Identity:41/163 - (25%)
Similarity:76/163 - (46%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1115 TPANKAQYQRAVQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRD 1179
            |.:|.|  .:.:|:|...:....|........||.:...:..::||..:.|:|.:|..|..|..:
  Fly    17 TCSNSA--VKRIQKELDEITRDPPQYCSAGPKEDNLYEWTSTIIGPADSVYENGIFKLDIFFPVE 79

  Fly  1180 YPKSPPVCHY---ISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLIL 1241
            ||.:|||..:   |.:|      |::..|.:|:.:|       .|.|||:.|:.::|:||..| |
  Fly    80 YPFAPPVVIFRTPIYHC------NIHRLGFICLDIL-------KEKWSPALTISKILLSICSL-L 130

  Fly  1242 VD----EPYYNEAGYEKQRGTQLGNENSRVYNE 1270
            .|    :|...:.|.|..:.....::.:|::.:
  Fly   131 TDCNPKDPLMAKIGTEYLKNRAEHDKKARLWTK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 38/152 (25%)
CG5440NP_001285558.1 COG5078 19..168 CDD:227410 40/161 (25%)
UQ_con 25..162 CDD:278603 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.