DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10254 and ube2d1b

DIOPT Version :9

Sequence 1:NP_651170.1 Gene:CG10254 / 42793 FlyBaseID:FBgn0027512 Length:1398 Species:Drosophila melanogaster
Sequence 2:NP_955958.1 Gene:ube2d1b / 324015 ZFINID:ZDB-GENE-030131-2735 Length:147 Species:Danio rerio


Alignment Length:152 Identity:39/152 - (25%)
Similarity:70/152 - (46%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1124 RAVQREYLMLKSSLPNGVVVRAYEDRMDLMSVMMVGPKRTPYQNALFFFDFQFGRDYPKSPPVCH 1188
            :.:|:|...|:...|.........|.:......::||..:|||..:||....|..|||..||   
Zfish     4 KRIQKELQDLQRDPPAQCSAGPVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPP--- 65

  Fly  1189 YISYCTDRLNPNLYEGGRVCVSLLGTWMGRDNEVWSPSSTMLQVLVSIQGLIL---VDEPYYNEA 1250
            .:::.|...:||:...|.:|:.:|       ...|||:.|:.:||:||..|:.   .|:|...:.
Zfish    66 KVAFTTKIYHPNINSNGSICLDIL-------RSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDI 123

  Fly  1251 GY----EKQRGTQLGNENSRVY 1268
            .:    :|::..:|..|.::.|
Zfish   124 AHIYKSDKEKYNRLAREWTQKY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10254NP_651170.1 UQ_con 1126..1272 CDD:278603 39/150 (26%)
ube2d1bNP_955958.1 UBCc 1..146 CDD:412187 39/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.